SCOPe 2.05: Domain d1el8b2: 1el8 B:218-321

Lineage for d1el8b2 (1el8 B:218-321)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)

6. Protein Sarcosine oxidase [54388] (1 species)

7. Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (16 PDB entries)

8. Domain d1el8b2: 1el8 B:218-321 [37942]
   Other proteins in same PDB: d1el8a1, d1el8b1
   complexed with cl, fad, msf, po4

Details for d1el8b2

PDB Entry: 1el8, 1.9 Å

PDB Description: complex of monomeric sarcosine oxidase with the inhibitor [methylseleno]cetate

PDB Compounds: (B:) sarcosine oxidase

SCOPe Domain Sequences for d1el8b2:

Sequence; same for both SEQRES and ATOM records:

>d1el8b2 d.16.1.3 (B:218-321) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp
dtinrefgvypedesnlrafleeympgangelkrgavcmytktl

Timeline for d1el8b2:

• d1el8b2 first appeared (with stable ids) in SCOP 1.55
  
• d1el8b2 appears in SCOPe 2.04
  
• d1el8b2 appears in SCOPe 2.06
  
• d1el8b2 appears in the current release, SCOPe 2.08