Lineage for d1el8b2 (1el8 B:218-321)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326096Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 326097Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 326171Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)
  6. 326215Protein Sarcosine oxidase [54388] (1 species)
  7. 326216Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (9 PDB entries)
  8. 326224Domain d1el8b2: 1el8 B:218-321 [37942]
    Other proteins in same PDB: d1el8a1, d1el8b1
    complexed with cl, fad, msf, po4

Details for d1el8b2

PDB Entry: 1el8 (more details), 1.9 Å

PDB Description: complex of monomeric sarcosine oxidase with the inhibitor [methylseleno]cetate

SCOP Domain Sequences for d1el8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1el8b2 d.16.1.3 (B:218-321) Sarcosine oxidase {Bacillus sp., strain b0618}
lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp
dtinrefgvypedesnlrafleeympgangelkrgavcmytktl

SCOP Domain Coordinates for d1el8b2:

Click to download the PDB-style file with coordinates for d1el8b2.
(The format of our PDB-style files is described here.)

Timeline for d1el8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1el8b1