Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein Zn metallo-beta-lactamase [56283] (12 species) |
Species Pseudomonas aeruginosa, VIM-2 [TaxId:287] [103316] (3 PDB entries) |
Domain d6sp7a_: 6sp7 A: [379419] automated match to d1ko3a_ complexed with act, k9b, zn |
PDB Entry: 6sp7 (more details), 1.8 Å
SCOPe Domain Sequences for d6sp7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sp7a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]} eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtn
Timeline for d6sp7a_: