SCOPe 2.08: Domain d6sp7a_: 6sp7 A:

Lineage for d6sp7a_ (6sp7 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein Zn metallo-beta-lactamase [56283] (14 species)

7. Species Pseudomonas aeruginosa, VIM-2 [TaxId:287] [103316] (3 PDB entries)

8. Domain d6sp7a_: 6sp7 A: [379419]
   automated match to d1ko3a_
   complexed with act, k9b, zn

Details for d6sp7a_

PDB Entry: 6sp7, 1.8 Å

PDB Description: crystal structure of the vim-2 acquired metallo-beta-lactamase in complex with taniborbactam (vnrx-5133)

PDB Compounds: (A:) Metallo-beta-lactamase VIM-2

SCOPe Domain Sequences for d6sp7a_:

Sequence; same for both SEQRES and ATOM records:

>d6sp7a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtn

Timeline for d6sp7a_:

• d6sp7a_ first appeared in SCOPe 2.07