Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
Protein automated matches [190149] (14 species) not a true protein |
Species Neisseria meningitidis [TaxId:487] [376758] (2 PDB entries) |
Domain d6vfxt_: 6vfx T: [379401] Other proteins in same PDB: d6vfxa_, d6vfxb_, d6vfxc_, d6vfxd_, d6vfxe_, d6vfxf_ automated match to d5g1sl_ complexed with adp, atp, mg |
PDB Entry: 6vfx (more details), 2.9 Å
SCOPe Domain Sequences for d6vfxt_:
Sequence, based on SEQRES records: (download)
>d6vfxt_ c.14.1.1 (T:) automated matches {Neisseria meningitidis [TaxId: 487]} ylvptvieqsgrgerafdiysrllkerivflvgpvtdesanlvvaqllflesenpdkdif fyinspggsvtagmsiydtmnfikpdvstlclgqaasmgafllsagekgkrfalpnsrim ihqplisgglggqasdieiharellkikeklnrlmakhcdrdladlerdtdrdnfmsaee akeyglidqilen
>d6vfxt_ c.14.1.1 (T:) automated matches {Neisseria meningitidis [TaxId: 487]} ylvptvieqsgerafdiysrllkerivflvgpvtdesanlvvaqllflesenpdkdiffy inspggsvtagmsiydtmnfikpdvstlclgqaasmgafllsagekgkrfalpnsrimih qplisgglggqasdieiharellkikeklnrlmakhcdrdladlerdtdrdnfmsaeeak eyglidqilen
Timeline for d6vfxt_: