Lineage for d6urvd_ (6urv D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798594Species Yellow fever virus [TaxId:11089] [379382] (1 PDB entry)
  8. 2798596Domain d6urvd_: 6urv D: [379400]
    Other proteins in same PDB: d6urva_, d6urvc_, d6urve_, d6urvg_
    automated match to d2ijob1

Details for d6urvd_

PDB Entry: 6urv (more details), 2.9 Å

PDB Description: crystal structure of yellow fever virus ns2b-ns3 protease domain
PDB Compounds: (D:) NS3 protease

SCOPe Domain Sequences for d6urvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6urvd_ b.47.1.0 (D:) automated matches {Yellow fever virus [TaxId: 11089]}
yledgiygifqstflgasqrgvgvaqggvfhtmwhvtrgaflvrngkklvpswasvkedl
vayggswkldgrwdgeeevqliaaapgknvvnvqtkpslfkvknggeigavaldypsgts
gspivnrngeviglygngilvgdnsfvsaisqt

SCOPe Domain Coordinates for d6urvd_:

Click to download the PDB-style file with coordinates for d6urvd_.
(The format of our PDB-style files is described here.)

Timeline for d6urvd_: