Lineage for d6urvg_ (6urv G:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643668Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)
  4. 2643669Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) (S)
    Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex
  5. 2643682Family g.96.1.0: automated matches [324385] (1 protein)
    not a true family
  6. 2643683Protein automated matches [324386] (3 species)
    not a true protein
  7. 2643684Species Yellow fever virus [TaxId:11089] [379377] (1 PDB entry)
  8. 2643688Domain d6urvg_: 6urv G: [379388]
    Other proteins in same PDB: d6urvb_, d6urvd_, d6urvf_, d6urvh_
    automated match to d5gpig_

Details for d6urvg_

PDB Entry: 6urv (more details), 2.9 Å

PDB Description: crystal structure of yellow fever virus ns2b-ns3 protease domain
PDB Compounds: (G:) ns2b

SCOPe Domain Sequences for d6urvg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6urvg_ g.96.1.0 (G:) automated matches {Yellow fever virus [TaxId: 11089]}
dglelrklgevsweeeaeisgssarydvtlseqgefkl

SCOPe Domain Coordinates for d6urvg_:

Click to download the PDB-style file with coordinates for d6urvg_.
(The format of our PDB-style files is described here.)

Timeline for d6urvg_: