Class g: Small proteins [56992] (98 folds) |
Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily) |
Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex |
Family g.96.1.0: automated matches [324385] (1 protein) not a true family |
Protein automated matches [324386] (3 species) not a true protein |
Species Yellow fever virus [TaxId:11089] [379377] (1 PDB entry) |
Domain d6urvg_: 6urv G: [379388] Other proteins in same PDB: d6urvb_, d6urvd_, d6urvf_, d6urvh_ automated match to d5gpig_ |
PDB Entry: 6urv (more details), 2.9 Å
SCOPe Domain Sequences for d6urvg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6urvg_ g.96.1.0 (G:) automated matches {Yellow fever virus [TaxId: 11089]} dglelrklgevsweeeaeisgssarydvtlseqgefkl
Timeline for d6urvg_: