Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (36 species) not a true protein |
Species Yellow fever virus [TaxId:11089] [379382] (1 PDB entry) |
Domain d6urvb_: 6urv B: [379384] Other proteins in same PDB: d6urva_, d6urvc_, d6urve_, d6urvg_ automated match to d2ijob1 |
PDB Entry: 6urv (more details), 2.9 Å
SCOPe Domain Sequences for d6urvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6urvb_ b.47.1.0 (B:) automated matches {Yellow fever virus [TaxId: 11089]} eyledgiygifqstflgasqrgvgvaqggvfhtmwhvtrgaflvrngkklvpswasvked lvayggswkldgrwdgeeevqliaaapgknvvnvqtkpslfkvknggeigavaldypsgt sgspivnrngeviglygngilvgdnsfvsaisqt
Timeline for d6urvb_: