Lineage for d1el5b2 (1el5 B:218-321)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131415Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 131416Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
  5. 131472Family d.16.1.3: D-amino acid oxidase-like [54384] (2 proteins)
  6. 131510Protein Sarcosine oxidase [54388] (1 species)
  7. 131511Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (6 PDB entries)
  8. 131517Domain d1el5b2: 1el5 B:218-321 [37938]
    Other proteins in same PDB: d1el5a1, d1el5b1

Details for d1el5b2

PDB Entry: 1el5 (more details), 1.8 Å

PDB Description: complex of monomeric sarcosine oxidase with the inhibitor dimethylglycine

SCOP Domain Sequences for d1el5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1el5b2 d.16.1.3 (B:218-321) Sarcosine oxidase {Bacillus sp., strain b0618}
lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp
dtinrefgvypedesnlrafleeympgangelkrgavcmytktl

SCOP Domain Coordinates for d1el5b2:

Click to download the PDB-style file with coordinates for d1el5b2.
(The format of our PDB-style files is described here.)

Timeline for d1el5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1el5b1