Lineage for d6urvc_ (6urv C:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3039002Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)
  4. 3039003Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) (S)
    Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex
  5. 3039016Family g.96.1.0: automated matches [324385] (1 protein)
    not a true family
  6. 3039017Protein automated matches [324386] (3 species)
    not a true protein
  7. 3039018Species Yellow fever virus [TaxId:11089] [379377] (1 PDB entry)
  8. 3039020Domain d6urvc_: 6urv C: [379379]
    Other proteins in same PDB: d6urvb_, d6urvd_, d6urvf_, d6urvh_
    automated match to d5gpig_

Details for d6urvc_

PDB Entry: 6urv (more details), 2.9 Å

PDB Description: crystal structure of yellow fever virus ns2b-ns3 protease domain
PDB Compounds: (C:) ns2b

SCOPe Domain Sequences for d6urvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6urvc_ g.96.1.0 (C:) automated matches {Yellow fever virus [TaxId: 11089]}
mdglelrklgevsweeeaeisgssarydvtlseqgefkl

SCOPe Domain Coordinates for d6urvc_:

Click to download the PDB-style file with coordinates for d6urvc_.
(The format of our PDB-style files is described here.)

Timeline for d6urvc_: