SCOPe 2.08: Domain d6urve_: 6urv E:

Lineage for d6urve_ (6urv E:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)

4. Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families)
   Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex

5. Family g.96.1.0: automated matches [324385] (1 protein)
   not a true family

6. Protein automated matches [324386] (3 species)
   not a true protein

7. Species Yellow fever virus [TaxId:11089] [379377] (1 PDB entry)

8. Domain d6urve_: 6urv E: [379378]
   Other proteins in same PDB: d6urvb_, d6urvd_, d6urvf_, d6urvh_
   automated match to d5gpig_

Details for d6urve_

PDB Entry: 6urv, 2.9 Å

PDB Description: crystal structure of yellow fever virus ns2b-ns3 protease domain

PDB Compounds: (E:) ns2b

SCOPe Domain Sequences for d6urve_:

Sequence; same for both SEQRES and ATOM records:

>d6urve_ g.96.1.0 (E:) automated matches {Yellow fever virus [TaxId: 11089]}
dglelrklgevsweeeaeisgssarydvtlseqgefkl

Timeline for d6urve_:

• d6urve_ first appeared in SCOPe 2.07