Lineage for d1c0ka2 (1c0k A:1194-1288)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30799Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 30800Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
  5. 30852Family d.16.1.3: D-amino acid oxidase-like [54384] (2 proteins)
  6. 30853Protein D-amino acid oxidase [54385] (2 species)
  7. 30885Species Yeast (Rhodotorula gracilis) [54387] (3 PDB entries)
  8. 30887Domain d1c0ka2: 1c0k A:1194-1288 [37935]
    Other proteins in same PDB: d1c0ka1

Details for d1c0ka2

PDB Entry: 1c0k (more details), 1.46 Å

PDB Description: crystal structure analysis of d-amino acid oxidase in complex with l- lactate
PDB Compounds: (A:)

SCOP Domain Sequences for d1c0ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0ka2 d.16.1.3 (A:1194-1288) D-amino acid oxidase {Yeast (Rhodotorula gracilis)}
aepirgqtvlvkspckrctmdssdpaspayiiprpggevicggtygvgdwdlsvnpetvq
rilkhclrldptissdgtiegievlrhnvglrpar

SCOP Domain Coordinates for d1c0ka2:

Click to download the PDB-style file with coordinates for d1c0ka2.
(The format of our PDB-style files is described here.)

Timeline for d1c0ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c0ka1