Lineage for d6o9hb1 (6o9h B:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742814Domain d6o9hb1: 6o9h B:1-113 [379342]
    Other proteins in same PDB: d6o9hb2, d6o9hl2
    automated match to d4rgne1
    complexed with na

Details for d6o9hb1

PDB Entry: 6o9h (more details), 2.1 Å

PDB Description: mouse ecd with fab1
PDB Compounds: (B:) light chain

SCOPe Domain Sequences for d6o9hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o9hb1 b.1.1.1 (B:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliswastr
dsgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklelk

SCOPe Domain Coordinates for d6o9hb1:

Click to download the PDB-style file with coordinates for d6o9hb1.
(The format of our PDB-style files is described here.)

Timeline for d6o9hb1: