Lineage for d6sp7e_ (6sp7 E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996779Species Pseudomonas aeruginosa, VIM-2 [TaxId:287] [103316] (3 PDB entries)
  8. 2996783Domain d6sp7e_: 6sp7 E: [379341]
    automated match to d1ko3a_
    complexed with act, k9b, zn

Details for d6sp7e_

PDB Entry: 6sp7 (more details), 1.8 Å

PDB Description: crystal structure of the vim-2 acquired metallo-beta-lactamase in complex with taniborbactam (vnrx-5133)
PDB Compounds: (E:) Metallo-beta-lactamase VIM-2

SCOPe Domain Sequences for d6sp7e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sp7e_ d.157.1.1 (E:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtn

SCOPe Domain Coordinates for d6sp7e_:

Click to download the PDB-style file with coordinates for d6sp7e_.
(The format of our PDB-style files is described here.)

Timeline for d6sp7e_: