SCOPe 2.08: Domain d6q27c2: 6q27 C:124-286

Lineage for d6q27c2 (6q27 C:124-286)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
duplication contains two domains of this fold
Family c.55.1.0: automated matches [227137] (1 protein)
not a true family
Protein automated matches [226839] (64 species)
not a true protein
Species Staphylococcus aureus [TaxId:1280] [379274] (3 PDB entries)
Domain d6q27c2: 6q27 C:124-286 [379337]
automated match to d2gupa2
complexed with bm3

Details for d6q27c2

PDB Entry: 6q27 (more details), 2.2 Å

PDB Description: n-acetylmannosamine kinase with n-acetylmannosamine from staphylococcus aureus

PDB Compounds: (C:) Glucokinase

SCOPe Domain Sequences for d6q27c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q27c2 c.55.1.0 (C:124-286) automated matches {Staphylococcus aureus [TaxId: 1280]}
aerifcmtlgtgiggayknnqghidngelhkanevgyllyrptenttfeqraatsalkkr
miaggftrsthvpvlfeaaeegddiakqilnewaedvaegiaqiqvmydpgliligggis
eqgdnlikyiepkvahylpkdyvyapiqttkskndaalygclq

SCOPe Domain Coordinates for d6q27c2:

Click to download the PDB-style file with coordinates for d6q27c2.
(The format of our PDB-style files is described here.)

Timeline for d6q27c2: