![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.100: Sortase [63816] (1 superfamily) barrel, closed; n=8, S=10; mixed sheet; two overside connections |
![]() | Superfamily b.100.1: Sortase [63817] (2 families) ![]() |
![]() | Family b.100.1.1: Sortase [63818] (3 proteins) |
![]() | Protein Sortase A [63819] (2 species) |
![]() | Species Staphylococcus aureus [TaxId:93061] [379323] (1 PDB entry) |
![]() | Domain d6r1va1: 6r1v A:2-148 [379324] Other proteins in same PDB: d6r1va2 automated match to d1ijaa_ complexed with jpt |
PDB Entry: 6r1v (more details)
SCOPe Domain Sequences for d6r1va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6r1va1 b.100.1.1 (A:2-148) Sortase A {Staphylococcus aureus [TaxId: 93061]} qakpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiag htfidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvevldeqkgkdkql tlitcddynektgvwekrkifvatevk
Timeline for d6r1va1: