Lineage for d6r1va1 (6r1v A:2-148)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430034Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. 2430035Superfamily b.100.1: Sortase [63817] (2 families) (S)
  5. 2430036Family b.100.1.1: Sortase [63818] (3 proteins)
  6. 2430042Protein Sortase A [63819] (2 species)
  7. 2430055Species Staphylococcus aureus [TaxId:93061] [379323] (1 PDB entry)
  8. 2430056Domain d6r1va1: 6r1v A:2-148 [379324]
    Other proteins in same PDB: d6r1va2
    automated match to d1ijaa_
    complexed with jpt

Details for d6r1va1

PDB Entry: 6r1v (more details)

PDB Description: solution structure of sortase a from s. aureus in complex with 2- (aminomethyl)-3-hydroxy-4h-pyran-4-one based prodrug
PDB Compounds: (A:) Sortase A

SCOPe Domain Sequences for d6r1va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r1va1 b.100.1.1 (A:2-148) Sortase A {Staphylococcus aureus [TaxId: 93061]}
qakpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiag
htfidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvevldeqkgkdkql
tlitcddynektgvwekrkifvatevk

SCOPe Domain Coordinates for d6r1va1:

Click to download the PDB-style file with coordinates for d6r1va1.
(The format of our PDB-style files is described here.)

Timeline for d6r1va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6r1va2