SCOPe 2.08: Domain d6r1va1: 6r1v A:2-148

Lineage for d6r1va1 (6r1v A:2-148)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.100: Sortase [63816] (1 superfamily)
   barrel, closed; n=8, S=10; mixed sheet; two overside connections

4. Superfamily b.100.1: Sortase [63817] (2 families)

5. Family b.100.1.1: Sortase [63818] (3 proteins)

6. Protein Sortase A [63819] (2 species)

7. Species Staphylococcus aureus [TaxId:93061] [379323] (1 PDB entry)

8. Domain d6r1va1: 6r1v A:2-148 [379324]
   Other proteins in same PDB: d6r1va2
   automated match to d1ijaa_
   complexed with jpt

Details for d6r1va1

PDB Entry: 6r1v

PDB Description: solution structure of sortase a from s. aureus in complex with 2- (aminomethyl)-3-hydroxy-4h-pyran-4-one based prodrug

PDB Compounds: (A:) Sortase A

SCOPe Domain Sequences for d6r1va1:

Sequence; same for both SEQRES and ATOM records:

>d6r1va1 b.100.1.1 (A:2-148) Sortase A {Staphylococcus aureus [TaxId: 93061]}
qakpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiag
htfidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvevldeqkgkdkql
tlitcddynektgvwekrkifvatevk

Timeline for d6r1va1:

• d6r1va1 first appeared in SCOPe 2.07