SCOPe 2.07: Domain d6pk0c1: 6pk0 C:25-265

Lineage for d6pk0c1 (6pk0 C:25-265)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries)

8. Domain d6pk0c1: 6pk0 C:25-265 [379294]
   Other proteins in same PDB: d6pk0a2, d6pk0b2, d6pk0c2, d6pk0d2
   automated match to d5tg5a_
   complexed with cl, gol, hiw

Details for d6pk0c1

PDB Entry: 6pk0, 1.75 Å

PDB Description: crystal structure of oxa-48 with hydrolyzed imipenem

PDB Compounds: (C:) OXA family beta-lactamase

SCOPe Domain Sequences for d6pk0c1:

Sequence; same for both SEQRES and ATOM records:

>d6pk0c1 e.3.1.0 (C:25-265) automated matches {Klebsiella pneumoniae [TaxId: 573]}
wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
iraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekii
p

Timeline for d6pk0c1:

• d6pk0c1 is new in SCOPe 2.07-stable
  
• d6pk0c1 appears in the current release, SCOPe 2.08