SCOPe 2.07: Domain d6ptuc1: 6ptu C:25-265

Lineage for d6ptuc1 (6ptu C:25-265)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries)

8. Domain d6ptuc1: 6ptu C:25-265 [379292]
   Other proteins in same PDB: d6ptua2, d6ptub2, d6ptuc2, d6ptud2
   automated match to d5tg5a_
   complexed with cl, id1

Details for d6ptuc1

PDB Entry: 6ptu, 2 Å

PDB Description: crystal structure of class d beta-lactamase oxa-48 with imipenem

PDB Compounds: (C:) Class D Carbapenemase OXA-48

SCOPe Domain Sequences for d6ptuc1:

Sequence; same for both SEQRES and ATOM records:

>d6ptuc1 e.3.1.0 (C:25-265) automated matches {Klebsiella pneumoniae [TaxId: 573]}
wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg
vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy
gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi
iraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekii
p

Timeline for d6ptuc1:

• d6ptuc1 is new in SCOPe 2.07-stable
  
• d6ptuc1 appears in the current release, SCOPe 2.08