SCOPe 2.07: Domain d1daoc2: 1dao C:195-287

Lineage for d1daoc2 (1dao C:195-287)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)

6. Protein D-aminoacid oxidase [54385] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [54386] (7 PDB entries)

8. Domain d1daoc2: 1dao C:195-287 [37928]
   Other proteins in same PDB: d1daoa1, d1daob1, d1daoc1, d1daod1, d1daoe1, d1daof1, d1daog1, d1daoh1
   complexed with fab

Details for d1daoc2

PDB Entry: 1dao, 3.2 Å

PDB Description: covalent adduct of d-amino acid oxidase from pig kidney with 3-methyl-2-oxo-valeric acid

PDB Compounds: (C:) d-amino acid oxidase

SCOPe Domain Sequences for d1daoc2:

Sequence; same for both SEQRES and ATOM records:

>d1daoc2 d.16.1.3 (C:195-287) D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823]}
lqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlggtfqvgnwneinniq
dhntiwegccrleptlkdakivgeytgfrpvrp

Timeline for d1daoc2:

• d1daoc2 first appeared (with stable ids) in SCOP 1.55
  
• d1daoc2 appears in SCOPe 2.06
  
• d1daoc2 appears in the current release, SCOPe 2.08