SCOPe 2.08: Domain d6q26a1: 6q26 A:1-123

Lineage for d6q26a1 (6q26 A:1-123)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [379274] (3 PDB entries)

8. Domain d6q26a1: 6q26 A:1-123 [379275]
   automated match to d2gupa1

Details for d6q26a1

PDB Entry: 6q26, 2.33 Å

PDB Description: n-acetylmannosamine kinase from staphylococcus aureus

PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d6q26a1:

Sequence; same for both SEQRES and ATOM records:

>d6q26a1 c.55.1.0 (A:1-123) automated matches {Staphylococcus aureus [TaxId: 1280]}
myyiaidiggtqiksavidkqlnmfdyqqistpdnkselitdkvyeivtgymkqyqliqp
vigissagvvdeqkgeivyagptipnykgtnfkrllkslspyvkvkndvnaallgelklh
qyq

Timeline for d6q26a1:

• d6q26a1 first appeared in SCOPe 2.07