Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins) |
Protein D-aminoacid oxidase [54385] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [54386] (7 PDB entries) |
Domain d1daob2: 1dao B:195-287 [37927] Other proteins in same PDB: d1daoa1, d1daob1, d1daoc1, d1daod1, d1daoe1, d1daof1, d1daog1, d1daoh1 complexed with fab |
PDB Entry: 1dao (more details), 3.2 Å
SCOPe Domain Sequences for d1daob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1daob2 d.16.1.3 (B:195-287) D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823]} lqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlggtfqvgnwneinniq dhntiwegccrleptlkdakivgeytgfrpvrp
Timeline for d1daob2: