Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [225260] (114 PDB entries) |
Domain d6pt1a1: 6pt1 A:25-265 [379265] Other proteins in same PDB: d6pt1a2, d6pt1b2, d6pt1c2, d6pt1d2 automated match to d5tg5a_ complexed with cl, gol, mer |
PDB Entry: 6pt1 (more details), 2 Å
SCOPe Domain Sequences for d6pt1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pt1a1 e.3.1.0 (A:25-265) automated matches {Klebsiella pneumoniae [TaxId: 573]} wqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslialdlg vvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlhafdy gnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteangdyi iraktgystriepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekii p
Timeline for d6pt1a1: