Lineage for d6pjwk_ (6pjw K:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866233Protein automated matches [190087] (15 species)
    not a true protein
  7. 2866302Species Methanotorris igneus [TaxId:2189] [379246] (3 PDB entries)
  8. 2866325Domain d6pjwk_: 6pjw K: [379251]
    automated match to d1ki9b_
    complexed with amp, mg

Details for d6pjwk_

PDB Entry: 6pjw (more details), 2.4 Å

PDB Description: adenylate kinase from methanococcus igneus - amp bound form
PDB Compounds: (K:) adenylate kinase

SCOPe Domain Sequences for d6pjwk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pjwk_ c.37.1.1 (K:) automated matches {Methanotorris igneus [TaxId: 2189]}
knkvvvvtgvpgvggttltqktieklkeegieykmvnfgtvmfevakeeglvedrdqmrk
ldpdtqkriqklagrkiaemakesnvivdthstvktpkgylaglpiwvleelnpdiiviv
etssdeilmrrlgdatrnrdieltsdidehqfmnrcaamaygvltgatvkiiknrdglld
kaveelisvlk

SCOPe Domain Coordinates for d6pjwk_:

Click to download the PDB-style file with coordinates for d6pjwk_.
(The format of our PDB-style files is described here.)

Timeline for d6pjwk_: