SCOPe 2.08: Domain d6pjwg_: 6pjw G:

Lineage for d6pjwg_ (6pjw G:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein automated matches [190087] (15 species)
   not a true protein

7. Species Methanotorris igneus [TaxId:2189] [379246] (3 PDB entries)

8. Domain d6pjwg_: 6pjw G: [379250]
   automated match to d1ki9b_
   complexed with amp, mg

Details for d6pjwg_

PDB Entry: 6pjw, 2.4 Å

PDB Description: adenylate kinase from methanococcus igneus - amp bound form

PDB Compounds: (G:) adenylate kinase

SCOPe Domain Sequences for d6pjwg_:

Sequence; same for both SEQRES and ATOM records:

>d6pjwg_ c.37.1.1 (G:) automated matches {Methanotorris igneus [TaxId: 2189]}
knkvvvvtgvpgvggttltqktieklkeegieykmvnfgtvmfevakeeglvedrdqmrk
ldpdtqkriqklagrkiaemakesnvivdthstvktpkgylaglpiwvleelnpdiiviv
etssdeilmrrlgdatrnrdieltsdidehqfmnrcaamaygvltgatvkiiknrdglld
kaveelisvlk

Timeline for d6pjwg_:

• d6pjwg_ first appeared in SCOPe 2.07