Lineage for d6j7xb_ (6j7x B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335598Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2335726Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 2335843Protein Rab geranylgeranyltransferase, beta subunit [48249] (2 species)
  7. 2335844Species Homo sapiens [TaxId:9606] [371046] (4 PDB entries)
  8. 2335846Domain d6j7xb_: 6j7x B: [379248]
    automated match to d1dceb_
    complexed with fmt, grg

Details for d6j7xb_

PDB Entry: 6j7x (more details), 2.75 Å

PDB Description: complex of ggtaseiii, farnesyl-ykt6, and ggpp
PDB Compounds: (B:) Geranylgeranyl transferase type-2 subunit beta

SCOPe Domain Sequences for d6j7xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j7xb_ a.102.4.3 (B:) Rab geranylgeranyltransferase, beta subunit {Homo sapiens [TaxId: 9606]}
qkdviiksdapdtlllekhadyiasygskkddyeycmseylrmsgiywgltvmdlmgqlh
rmnreeilafikscqhecggisasighdphllytlsavqiltlydsinvidvnkvveyvk
glqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfgcr
pgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcysww
vlaslkiigrlhwidreklrnfilacqdeetggfadrpgdmvdpfhtlfgiaglsllgee
qikpvnpvfcmpeevlqrvnvqpelvs

SCOPe Domain Coordinates for d6j7xb_:

Click to download the PDB-style file with coordinates for d6j7xb_.
(The format of our PDB-style files is described here.)

Timeline for d6j7xb_: