Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
Protein automated matches [190252] (5 species) not a true protein |
Species Avena sativa [TaxId:4498] [379243] (1 PDB entry) |
Domain d6ntpa_: 6ntp A: [379244] automated match to d4qbwa_ complexed with mg |
PDB Entry: 6ntp (more details), 1.89 Å
SCOPe Domain Sequences for d6ntpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ntpa_ c.45.1.2 (A:) automated matches {Avena sativa [TaxId: 4498]} emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim
Timeline for d6ntpa_: