Lineage for d6ntpa_ (6ntp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875255Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2875600Protein automated matches [190252] (5 species)
    not a true protein
  7. 2875601Species Avena sativa [TaxId:4498] [379243] (1 PDB entry)
  8. 2875602Domain d6ntpa_: 6ntp A: [379244]
    automated match to d4qbwa_
    complexed with mg

Details for d6ntpa_

PDB Entry: 6ntp (more details), 1.89 Å

PDB Description: ptp1b domain of ptp1b-lov2 chimera
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 1,NPH1-1

SCOPe Domain Sequences for d6ntpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ntpa_ c.45.1.2 (A:) automated matches {Avena sativa [TaxId: 4498]}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim

SCOPe Domain Coordinates for d6ntpa_:

Click to download the PDB-style file with coordinates for d6ntpa_.
(The format of our PDB-style files is described here.)

Timeline for d6ntpa_: