Lineage for d1ddof2 (1ddo F:195-287)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30799Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 30800Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
  5. 30852Family d.16.1.3: D-amino acid oxidase-like [54384] (2 protein domains)
  6. 30853Protein D-amino acid oxidase [54385] (2 species)
  7. 30854Species Pig (Sus scrofa) [TaxId:9823] [54386] (6 PDB entries)
  8. 30882Domain d1ddof2: 1ddo F:195-287 [37923]
    Other proteins in same PDB: d1ddoa1, d1ddob1, d1ddoc1, d1ddod1, d1ddoe1, d1ddof1, d1ddog1, d1ddoh1

Details for d1ddof2

PDB Entry: 1ddo (more details), 3.1 Å

PDB Description: reduced d-amino acid oxidase from pig kidney in complex with imino-trp

SCOP Domain Sequences for d1ddof2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddof2 d.16.1.3 (F:195-287) D-amino acid oxidase {Pig (Sus scrofa)}
lqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlggtfqvgnwneinniq
dhntiwegccrleptlkdakivgeytgfrpvrp

SCOP Domain Coordinates for d1ddof2:

Click to download the PDB-style file with coordinates for d1ddof2.
(The format of our PDB-style files is described here.)

Timeline for d1ddof2: