Lineage for d6jfvb_ (6jfv B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040442Superfamily h.1.20: Intermediate filament protein, coiled coil region [64593] (2 families) (S)
  5. 3040462Family h.1.20.0: automated matches [254316] (1 protein)
    not a true family
  6. 3040463Protein automated matches [254726] (1 species)
    not a true protein
  7. 3040464Species Human (Homo sapiens) [TaxId:9606] [256106] (6 PDB entries)
  8. 3040474Domain d6jfvb_: 6jfv B: [379224]
    automated match to d1gk4a_
    mutant

Details for d6jfvb_

PDB Entry: 6jfv (more details), 2.6 Å

PDB Description: the crystal structure of 2b-2b complex from keratins 5 and 14 (c367a mutant of k14)
PDB Compounds: (B:) Keratin, type II cytoskeletal 5

SCOPe Domain Sequences for d6jfvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jfvb_ h.1.20.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tkheisemnrmiqrlraeidnvkkqcanlqnaiadaeqrgelalkdarnklaeleealqk
akqdmarllreyqelmntklaldveiatyrklleg

SCOPe Domain Coordinates for d6jfvb_:

Click to download the PDB-style file with coordinates for d6jfvb_.
(The format of our PDB-style files is described here.)

Timeline for d6jfvb_: