SCOPe 2.08: Domain d6j92b_: 6j92 B:

Lineage for d6j92b_ (6j92 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily)
   duplication: consists of two similar beta-alpha-beta(4) motifs

4. Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families)
   characteristic metal ion (zinc)-binding motif in the putative active site

5. Family d.290.1.0: automated matches [191426] (1 protein)
   not a true family

6. Protein automated matches [190613] (9 species)
   not a true protein

7. Species Klebsiella aerogenes [TaxId:548] [358657] (2 PDB entries)

8. Domain d6j92b_: 6j92 B: [379210]
   automated match to d1xv2a_
   complexed with cl, zn

Details for d6j92b_

PDB Entry: 6j92, 2.42 Å

PDB Description: crystal structure of acetolactate decarboxylase from enterbacter aerogenes

PDB Compounds: (B:) alpha-acetolactate decarboxylase

SCOPe Domain Sequences for d6j92b_:

Sequence; same for both SEQRES and ATOM records:

>d6j92b_ d.290.1.0 (B:) automated matches {Klebsiella aerogenes [TaxId: 548]}
sviyqtslmsallsgvyegdttiadllahgdfglgtfneldgemiafssqvyqlradgsa
raakpeqktpfavmtwfqpqyrktfdapvsrqqihdvidqqipsdnlfcalridgnfrha
htrtvprqtppyramtdvlddqpvfrfnqregvlvgfrtpqhmqginvagyhehfitddr
qggghlldyqlesgvltfgeihklmidlp

Timeline for d6j92b_:

• d6j92b_ first appeared in SCOPe 2.07