Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily) duplication: consists of two similar beta-alpha-beta(4) motifs |
Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families) characteristic metal ion (zinc)-binding motif in the putative active site |
Family d.290.1.0: automated matches [191426] (1 protein) not a true family |
Protein automated matches [190613] (9 species) not a true protein |
Species Klebsiella aerogenes [TaxId:548] [358657] (2 PDB entries) |
Domain d6j92b_: 6j92 B: [379210] automated match to d1xv2a_ complexed with cl, zn |
PDB Entry: 6j92 (more details), 2.42 Å
SCOPe Domain Sequences for d6j92b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j92b_ d.290.1.0 (B:) automated matches {Klebsiella aerogenes [TaxId: 548]} sviyqtslmsallsgvyegdttiadllahgdfglgtfneldgemiafssqvyqlradgsa raakpeqktpfavmtwfqpqyrktfdapvsrqqihdvidqqipsdnlfcalridgnfrha htrtvprqtppyramtdvlddqpvfrfnqregvlvgfrtpqhmqginvagyhehfitddr qggghlldyqlesgvltfgeihklmidlp
Timeline for d6j92b_: