Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Arabidopsis thaliana [TaxId:3702] [369474] (7 PDB entries) |
Domain d6j94b_: 6j94 B: [379193] automated match to d4r21a_ complexed with hem |
PDB Entry: 6j94 (more details), 2.4 Å
SCOPe Domain Sequences for d6j94b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j94b_ a.104.1.0 (B:) automated matches {Arabidopsis thaliana [TaxId: 3702]} neaffiplyelfltyggifrltfgpksflivsdpsiakhilkdnakayskgilaeildfv mgkglipadgeiwrrrrraivpalhqkyvaamislfgeasdrlcqkldaaalkgeeveme slfsrltldiigkavfnydfdsltndtgvieavytvlreaedrsvspipvwdipiwkdis prqrkvatslklindtlddliatckrmveeeelqfheeymnerdpsilhfllasgddvss kqlrddlmtmliaghetsaavltwtfyllttepsvvaklqeevdsvigdrfptiqdmkkl kyttrvmneslrlypqppvlirrsidndilgeypikrgedifisvwnlhrsplhwddaek fnperwpldgpnpnetnqnfsylpfgggprkcigdmfasfenvvaiamlirrfnfqiapg appvkmttgatihtteglkltvtkrtkpldipsvpil
Timeline for d6j94b_: