Lineage for d6iqna1 (6iqn A:502-790)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2984910Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)
  8. 2986760Domain d6iqna1: 6iqn A:502-790 [379189]
    Other proteins in same PDB: d6iqna2, d6iqnb2
    automated match to d5kmla1
    complexed with aq6

Details for d6iqna1

PDB Entry: 6iqn (more details), 2.54 Å

PDB Description: crystal structure of trka kinase with ligand
PDB Compounds: (A:) high affinity nerve growth factor receptor

SCOPe Domain Sequences for d6iqna1:

Sequence, based on SEQRES records: (download)

>d6iqna1 d.144.1.0 (A:502-790) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vhhikrrdivlkwelgegafgkvflaechnllpeqdkmlvavkalkeasesarqdfqrea
elltmlqhqhivrffgvctegrpllmvfeymrhgdlnrflrshgpdakllaggedvapgp
lglgqllavasqvaagmvylaglhfvhrdlatrnclvgqglvvkigdfgmsrdiystdyy
rvggrtmlpirwmppesilyrkfttesdvwsfgvvlweiftygkqpwyqlsnteaidcit
qgrelerpracppevyaimrgcwqrepqqrhsikdvharlqalaqappv

Sequence, based on observed residues (ATOM records): (download)

>d6iqna1 d.144.1.0 (A:502-790) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vhhikrrdivlkwelgegafgkvflaechnllpkmlvavkalkesarqdfqreaelltml
qhqhivrffgvctegrpllmvfeymrhgdlnrflrshgpdakllaggedvapgplglgql
lavasqvaagmvylaglhfvhrdlatrnclvgqglvvkigdftdyyrtmlpirwmppesi
lyrkfttesdvwsfgvvlweiftygkqpwyqlsnteaidcitqgrelerpracppevyai
mrgcwqrepqqrhsikdvharlqalaqappv

SCOPe Domain Coordinates for d6iqna1:

Click to download the PDB-style file with coordinates for d6iqna1.
(The format of our PDB-style files is described here.)

Timeline for d6iqna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6iqna2