Lineage for d1ddoa2 (1ddo A:195-287)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78269Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 78270Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
  5. 78322Family d.16.1.3: D-amino acid oxidase-like [54384] (2 proteins)
  6. 78323Protein D-amino acid oxidase [54385] (2 species)
  7. 78324Species Pig (Sus scrofa) [TaxId:9823] [54386] (6 PDB entries)
  8. 78347Domain d1ddoa2: 1ddo A:195-287 [37918]
    Other proteins in same PDB: d1ddoa1, d1ddob1, d1ddoc1, d1ddod1, d1ddoe1, d1ddof1, d1ddog1, d1ddoh1

Details for d1ddoa2

PDB Entry: 1ddo (more details), 3.1 Å

PDB Description: reduced d-amino acid oxidase from pig kidney in complex with imino-trp

SCOP Domain Sequences for d1ddoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddoa2 d.16.1.3 (A:195-287) D-amino acid oxidase {Pig (Sus scrofa)}
lqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlggtfqvgnwneinniq
dhntiwegccrleptlkdakivgeytgfrpvrp

SCOP Domain Coordinates for d1ddoa2:

Click to download the PDB-style file with coordinates for d1ddoa2.
(The format of our PDB-style files is described here.)

Timeline for d1ddoa2: