Lineage for d6v3ua_ (6v3u A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603556Species Erythrobacter litoralis [TaxId:314225] [379172] (1 PDB entry)
  8. 2603557Domain d6v3ua_: 6v3u A: [379176]
    automated match to d4eyba_
    complexed with edo, ipa, ocs, so4, zn

Details for d6v3ua_

PDB Entry: 6v3u (more details), 2 Å

PDB Description: crystal structure of the ndm_fim-1 like metallo-beta-lactamase from erythrobacter litoralis in the mono-zinc form
PDB Compounds: (A:) beta-lactamase II

SCOPe Domain Sequences for d6v3ua_:

Sequence, based on SEQRES records: (download)

>d6v3ua_ d.157.1.0 (A:) automated matches {Erythrobacter litoralis [TaxId: 314225]}
iirfgevsfsqlaegvwmhttyldlmgfgpipsngllvvngdntilvdtawtdeqteqiv
awasmvlakpvraavvthahqdkmggmaalhganiatwahplsnelapeeglvparnait
fdangwatgeaaqslaplrlyypggahtrdnitvglpelgiafggcmikagdasnlgnla
dadtaayaqsvrnfaaafpdartiamshsppegrkaiertldlaeel

Sequence, based on observed residues (ATOM records): (download)

>d6v3ua_ d.157.1.0 (A:) automated matches {Erythrobacter litoralis [TaxId: 314225]}
iirfgevsfsqlaegvwmhttyldlmgfgpipsngllvvngdntilvdtawtdeqteqiv
awasmvlakpvraavvthahqdkmggmaalhganiatwahplarnaitfdangwatgeaa
qslaplrlyypggahtrdnitvglpelgiafggcmikagdasnlgnladadtaayaqsvr
nfaaafpdartiamshsppegrkaiertldlaeel

SCOPe Domain Coordinates for d6v3ua_:

Click to download the PDB-style file with coordinates for d6v3ua_.
(The format of our PDB-style files is described here.)

Timeline for d6v3ua_: