SCOPe 2.07: Domain d6v91a1: 6v91 A:1-78

Lineage for d6v91a1 (6v91 A:1-78)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [379159] (1 PDB entry)

8. Domain d6v91a1: 6v91 A:1-78 [379160]
   Other proteins in same PDB: d6v91a2, d6v91a3, d6v91b2
   automated match to d4qq7a1
   complexed with act, edo, fmt

Details for d6v91a1

PDB Entry: 6v91, 1.9 Å

PDB Description: crystal structure of stringent starvation protein a (bth_i2974) from burkholderia thailandensis

PDB Compounds: (A:) stringent starvation protein A

SCOPe Domain Sequences for d6v91a1:

Sequence; same for both SEQRES and ATOM records:

>d6v91a1 c.47.1.0 (A:1-78) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mmvlysgttcpfsqrcrlvlfekgmdfeirdvdlfnkpediavmnpygqvpilverdlil
yesniineyiderfphpq

Timeline for d6v91a1:

• d6v91a1 is new in SCOPe 2.07-stable
  
• d6v91a1 appears in the current release, SCOPe 2.08