Lineage for d6tted3 (6tte D:334-625)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2439241Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2439329Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2439337Species Escherichia coli [TaxId:562] [51511] (45 PDB entries)
    Uniprot P00722
  8. 2439473Domain d6tted3: 6tte D:334-625 [379145]
    Other proteins in same PDB: d6ttea1, d6ttea2, d6ttea4, d6ttea5, d6tteb1, d6tteb2, d6tteb4, d6tteb5, d6ttec1, d6ttec2, d6ttec4, d6ttec5, d6tted1, d6tted2, d6tted4, d6tted5
    automated match to d1jz7a5
    complexed with mg, ptq

Details for d6tted3

PDB Entry: 6tte (more details), 2.2 Å

PDB Description: beta-galactosidase in complex with petg
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d6tted3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tted3 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d6tted3:

Click to download the PDB-style file with coordinates for d6tted3.
(The format of our PDB-style files is described here.)

Timeline for d6tted3: