Class b: All beta proteins [48724] (178 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein beta-Galactosidase [49804] (3 species) |
Species Escherichia coli [TaxId:562] [49805] (45 PDB entries) Uniprot P00722 |
Domain d6tted1: 6tte D:10-219 [379143] Other proteins in same PDB: d6ttea2, d6ttea3, d6ttea4, d6ttea5, d6tteb2, d6tteb3, d6tteb4, d6tteb5, d6ttec2, d6ttec3, d6ttec4, d6ttec5, d6tted2, d6tted3, d6tted4, d6tted5 automated match to d1f4ha3 complexed with mg, ptq |
PDB Entry: 6tte (more details), 2.2 Å
SCOPe Domain Sequences for d6tted1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tted1 b.18.1.5 (D:10-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} vlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeav peswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnv deswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvl rwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d6tted1:
View in 3D Domains from same chain: (mouse over for more information) d6tted2, d6tted3, d6tted4, d6tted5 |