Lineage for d6tted1 (6tte D:10-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2383918Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2383919Protein beta-Galactosidase [49804] (3 species)
  7. 2383927Species Escherichia coli [TaxId:562] [49805] (45 PDB entries)
    Uniprot P00722
  8. 2384063Domain d6tted1: 6tte D:10-219 [379143]
    Other proteins in same PDB: d6ttea2, d6ttea3, d6ttea4, d6ttea5, d6tteb2, d6tteb3, d6tteb4, d6tteb5, d6ttec2, d6ttec3, d6ttec4, d6ttec5, d6tted2, d6tted3, d6tted4, d6tted5
    automated match to d1f4ha3
    complexed with mg, ptq

Details for d6tted1

PDB Entry: 6tte (more details), 2.2 Å

PDB Description: beta-galactosidase in complex with petg
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d6tted1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tted1 b.18.1.5 (D:10-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
vlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeav
peswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnv
deswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvl
rwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d6tted1:

Click to download the PDB-style file with coordinates for d6tted1.
(The format of our PDB-style files is described here.)

Timeline for d6tted1: