Lineage for d6tteb2 (6tte B:220-333)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2359630Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2359631Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2359632Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2359646Species Escherichia coli [TaxId:562] [49306] (44 PDB entries)
    Uniprot P00722
  8. 3079076Domain d6tteb2: 6tte B:220-333 [379138]
    Other proteins in same PDB: d6ttea1, d6ttea3, d6ttea5, d6tteb1, d6tteb3, d6tteb5, d6ttec1, d6ttec3, d6ttec5, d6tted1, d6tted3, d6tted5
    automated match to d1jz8a1
    complexed with mg, ptq

Details for d6tteb2

PDB Entry: 6tte (more details), 2.2 Å

PDB Description: beta-galactosidase in complex with petg
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d6tteb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tteb2 b.1.4.1 (B:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d6tteb2:

Click to download the PDB-style file with coordinates for d6tteb2.
(The format of our PDB-style files is described here.)

Timeline for d6tteb2:

  • d6tteb2 is new in SCOPe 2.07-stable