Lineage for d6ttea5 (6tte A:731-1023)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2375752Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2375891Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2375892Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2375893Protein beta-Galactosidase, domain 5 [49996] (3 species)
  7. 2375901Species Escherichia coli [TaxId:562] [49997] (44 PDB entries)
    Uniprot P00722
  8. 3079071Domain d6ttea5: 6tte A:731-1023 [379133]
    Other proteins in same PDB: d6ttea1, d6ttea2, d6ttea3, d6ttea4, d6tteb1, d6tteb2, d6tteb3, d6tteb4, d6ttec1, d6ttec2, d6ttec3, d6ttec4, d6tted1, d6tted2, d6tted3, d6tted4
    automated match to d1jz8a4
    complexed with mg, ptq

Details for d6ttea5

PDB Entry: 6tte (more details), 2.2 Å

PDB Description: beta-galactosidase in complex with petg
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d6ttea5:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ttea5 b.30.5.1 (A:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d6ttea5:

Click to download the PDB-style file with coordinates for d6ttea5.
(The format of our PDB-style files is described here.)

Timeline for d6ttea5:

  • d6ttea5 is new in SCOPe 2.07-stable