Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein beta-Galactosidase, domain 3 [51510] (3 species) |
Species Escherichia coli [TaxId:562] [51511] (46 PDB entries) Uniprot P00722 |
Domain d6ttea3: 6tte A:334-625 [379131] Other proteins in same PDB: d6ttea1, d6ttea2, d6ttea4, d6ttea5, d6tteb1, d6tteb2, d6tteb4, d6tteb5, d6ttec1, d6ttec2, d6ttec4, d6ttec5, d6tted1, d6tted2, d6tted4, d6tted5 automated match to d1jz7a5 complexed with mg, ptq |
PDB Entry: 6tte (more details), 2.2 Å
SCOPe Domain Sequences for d6ttea3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ttea3 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d6ttea3:
View in 3D Domains from same chain: (mouse over for more information) d6ttea1, d6ttea2, d6ttea4, d6ttea5 |