Lineage for d6ttea3 (6tte A:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830645Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2830653Species Escherichia coli [TaxId:562] [51511] (46 PDB entries)
    Uniprot P00722
  8. 2830770Domain d6ttea3: 6tte A:334-625 [379131]
    Other proteins in same PDB: d6ttea1, d6ttea2, d6ttea4, d6ttea5, d6tteb1, d6tteb2, d6tteb4, d6tteb5, d6ttec1, d6ttec2, d6ttec4, d6ttec5, d6tted1, d6tted2, d6tted4, d6tted5
    automated match to d1jz7a5
    complexed with mg, ptq

Details for d6ttea3

PDB Entry: 6tte (more details), 2.2 Å

PDB Description: beta-galactosidase in complex with petg
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d6ttea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ttea3 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d6ttea3:

Click to download the PDB-style file with coordinates for d6ttea3.
(The format of our PDB-style files is described here.)

Timeline for d6ttea3: