SCOPe 2.08: Domain d6t48a_: 6t48 A:

Lineage for d6t48a_ (6t48 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (27 species)
   not a true protein

7. Species Enterovirus f [TaxId:1330520] [379113] (3 PDB entries)

8. Domain d6t48a_: 6t48 A: [379114]
   automated match to d5osna_
   complexed with cl, cys, gly, gol, gsh, k, so4, ste

Details for d6t48a_

PDB Entry: 6t48, 2.17 Å

PDB Description: bovine enterovirus f3 in complex with glutathione and a cysteinylglycine dipeptide

PDB Compounds: (A:) vp1

SCOPe Domain Sequences for d6t48a_:

Sequence; same for both SEQRES and ATOM records:

>d6t48a_ b.121.4.1 (A:) automated matches {Enterovirus f [TaxId: 1330520]}
gqviksavrstventvqsthsitteatpalqaaetgatsnasdesmietrnvvnthgvae
tsleafygraglvamfstdggiyrwyinfgeyvqlraklelltyarfdmeftivaqvvna
qskvqdfnvdyqvmfvppgasvpenqdsyqwqsscnpsvisntglpparvsvpfmssana
ysfsydgytqfgdtsgssygivpsnylgmlvvrtcedldgtrlrvrvyakpkhvkgwipr
sprmtpyksrytgvytdttkfcanraritta

Timeline for d6t48a_:

• d6t48a_ first appeared in SCOPe 2.07