Lineage for d6sdya1 (6sdy A:205-274)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2947034Family d.50.1.0: automated matches [254259] (1 protein)
    not a true family
  6. 2947035Protein automated matches [254599] (2 species)
    not a true protein
  7. 2947039Species Human (Homo sapiens) [TaxId:9606] [379109] (1 PDB entry)
  8. 2947040Domain d6sdya1: 6sdy A:205-274 [379110]
    Other proteins in same PDB: d6sdya2
    automated match to d1di2a_
    protein/RNA complex

Details for d6sdya1

PDB Entry: 6sdy (more details)

PDB Description: solution structure of staufen1 dsrbd4 - harf1 sbs dsrna complex.
PDB Compounds: (A:) Double-stranded RNA-binding protein Staufen homolog 1

SCOPe Domain Sequences for d6sdya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sdya1 d.50.1.0 (A:205-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npisrlaqiqqakkekepeytllterglprrrefvmqvkvgnhtaegtgtnkkvakrnaa
enmleilgfk

SCOPe Domain Coordinates for d6sdya1:

Click to download the PDB-style file with coordinates for d6sdya1.
(The format of our PDB-style files is described here.)

Timeline for d6sdya1: