Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Muricauda sp. [TaxId:1250232] [379088] (1 PDB entry) |
Domain d6q78b_: 6q78 B: [379089] automated match to d4cd5a_ complexed with trs |
PDB Entry: 6q78 (more details), 1.5 Å
SCOPe Domain Sequences for d6q78b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6q78b_ c.1.8.0 (B:) automated matches {Muricauda sp. [TaxId: 1250232]} geldfepeetrsfmvnpdateetvalfynlkllsqnsfivgqqdafssfyqdnagdsdik kmtgsdpgllgsdfmfitddlndgtpsnwffqqenqirddvlrafdmglvnvfcwhfrep fegehfytsemtqfqrenalksilpggenhdyykqklekiasftkslvgsngalvpiifr pfhefdgdwfwwgqsfctieeyiqlwqftvtylkntlsvnnmlfafspdnrffseseyla rypgddfvdimgmdnygdfnnqgqagveranqklkivsdlaeervkiasltetgyfvtls engaipgfftnnlfealthndvkigftmfwynyqdtyctpvpglpsandfmefvskpevi laddlpemyrlppn
Timeline for d6q78b_: