SCOPe 2.08: Domain d6q78b_: 6q78 B:

Lineage for d6q78b_ (6q78 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (132 species)
   not a true protein

7. Species Muricauda sp. [TaxId:1250232] [379088] (1 PDB entry)

8. Domain d6q78b_: 6q78 B: [379089]
   automated match to d4cd5a_
   complexed with trs

Details for d6q78b_

PDB Entry: 6q78, 1.5 Å

PDB Description: the structure of gh26c from muricauda sp. mar_2010_75

PDB Compounds: (B:) gh26c

SCOPe Domain Sequences for d6q78b_:

Sequence; same for both SEQRES and ATOM records:

>d6q78b_ c.1.8.0 (B:) automated matches {Muricauda sp. [TaxId: 1250232]}
geldfepeetrsfmvnpdateetvalfynlkllsqnsfivgqqdafssfyqdnagdsdik
kmtgsdpgllgsdfmfitddlndgtpsnwffqqenqirddvlrafdmglvnvfcwhfrep
fegehfytsemtqfqrenalksilpggenhdyykqklekiasftkslvgsngalvpiifr
pfhefdgdwfwwgqsfctieeyiqlwqftvtylkntlsvnnmlfafspdnrffseseyla
rypgddfvdimgmdnygdfnnqgqagveranqklkivsdlaeervkiasltetgyfvtls
engaipgfftnnlfealthndvkigftmfwynyqdtyctpvpglpsandfmefvskpevi
laddlpemyrlppn

Timeline for d6q78b_:

• d6q78b_ first appeared in SCOPe 2.07