Lineage for d1kifa2 (1kif A:195-287)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30799Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
  4. 30800Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
  5. 30852Family d.16.1.3: D-amino acid oxidase-like [54384] (2 proteins)
  6. 30853Protein D-amino acid oxidase [54385] (2 species)
  7. 30854Species Pig (Sus scrofa) [TaxId:9823] [54386] (6 PDB entries)
  8. 30859Domain d1kifa2: 1kif A:195-287 [37908]
    Other proteins in same PDB: d1kifa1, d1kifb1, d1kifc1, d1kifd1, d1kife1, d1kiff1, d1kifg1, d1kifh1

Details for d1kifa2

PDB Entry: 1kif (more details), 2.6 Å

PDB Description: d-amino acid oxidase from pig kidney

SCOP Domain Sequences for d1kifa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kifa2 d.16.1.3 (A:195-287) D-amino acid oxidase {Pig (Sus scrofa)}
lqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlggtfqvgnwneinniq
dhntiwegccrleptlkdakivgeytgfrpvrp

SCOP Domain Coordinates for d1kifa2:

Click to download the PDB-style file with coordinates for d1kifa2.
(The format of our PDB-style files is described here.)

Timeline for d1kifa2: