![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
![]() | Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
![]() | Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (2 proteins) insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243 |
![]() | Protein automated matches [378998] (3 species) not a true protein |
![]() | Species Geobacillus stearothermophilus [TaxId:1422] [378999] (4 PDB entries) |
![]() | Domain d6nmka1: 6nmk A:2-125 [379045] Other proteins in same PDB: d6nmka2, d6nmkb2 automated match to d1knya2 protein/DNA complex; complexed with ca, mg, nmy; mutant |
PDB Entry: 6nmk (more details), 1.94 Å
SCOPe Domain Sequences for d6nmka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nmka1 d.218.1.1 (A:2-125) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} ngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmstee aefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvyq taks
Timeline for d6nmka1: