Lineage for d6nmkb1 (6nmk B:1-125)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3006868Family d.218.1.1: Kanamycin nucleotidyltransferase (KNTase), N-terminal domain [56708] (2 proteins)
    insert X in the core is a beta-strand ; mixed 4-stranded sheet, order: 1243
  6. 3006875Protein automated matches [378998] (3 species)
    not a true protein
  7. 3006885Species Geobacillus stearothermophilus [TaxId:1422] [378999] (4 PDB entries)
  8. 3006889Domain d6nmkb1: 6nmk B:1-125 [379037]
    Other proteins in same PDB: d6nmka2, d6nmkb2
    automated match to d1knya2
    protein/DNA complex; complexed with ca, mg, nmy; mutant

Details for d6nmkb1

PDB Entry: 6nmk (more details), 1.94 Å

PDB Description: binary complex structure of the t130k mutant of ant-4'' with neomycin
PDB Compounds: (B:) kanamycin nucleotidyltransferase

SCOPe Domain Sequences for d6nmkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nmkb1 d.218.1.1 (B:1-125) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mngpiimtreermkivheikerildkygddvkaigvygslgrqtdgpysdiemmcvmste
eaefshewttgewkvevnfdseeilldyasqvesdwplthgqffsilpiydsggylekvy
qtaks

SCOPe Domain Coordinates for d6nmkb1:

Click to download the PDB-style file with coordinates for d6nmkb1.
(The format of our PDB-style files is described here.)

Timeline for d6nmkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6nmkb2