SCOPe 2.08: Domain d6nm1b_: 6nm1 B:

Lineage for d6nm1b_ (6nm1 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
   2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]

4. Superfamily c.119.1: DAK1/DegV-like [82549] (3 families)
   domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different

5. Family c.119.1.0: automated matches [191443] (1 protein)
   not a true family

6. Protein automated matches [190655] (13 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [347708] (7 PDB entries)

8. Domain d6nm1b_: 6nm1 B: [379032]
   automated match to d3pl5a_
   complexed with myr; mutant

Details for d6nm1b_

PDB Entry: 6nm1, 2.33 Å

PDB Description: the crystal structure of the staphylococcus aureus fatty acid kinase (fak) b1 protein a158l mutant to 2.33 angstrom resolution exhibits a conformation change compared to the wild type form

PDB Compounds: (B:) Fatty Acid Kinase (Fak) B1 protein

SCOPe Domain Sequences for d6nm1b_:

Sequence, based on SEQRES records:

>d6nm1b_ c.119.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkiavmtdstsylsqdlidkyniqiaplsvtfddgknftesneiaieefynkmassqtip
ttsqpaigewitkyemlrdqgytdiiviclssgisgsyqssyqagemvegvnvhafdskl
aamiegcyvlraiemveegyepqqiiddltnmrehtglylivddlknlqksgritgaqaw
vgtllkmkpvlkfedgkiipeekvrtkkraiqtlekkvldivkdfeevtlfvingdhfed
gqalykklqddcpsayqvaysefgpvvaahlgsgglglgyvgrkirlt

Sequence, based on observed residues (ATOM records):

>d6nm1b_ c.119.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkiavmtdstsylsqdlidkyniqiaplsvtfddgknftesneiaieefynkmassqtip
ttsqpaigewitkyemlrdqgytdiiviclssgisgsyqssyqagemvegvnvhafdskl
aamiegcyvlraiemveegyepqqiiddltnmrehtglylivddlknlqksgritawvgt
llkmkpvlkfedgkiipeekvrtkkraiqtlekkvldivkdfeevtlfvingdhfedgqa
lykklqddcpsayqvaysefgpvvaahlgsgglglgyvgrkirlt

Timeline for d6nm1b_:

• d6nm1b_ first appeared in SCOPe 2.07