Lineage for d1fohc4 (1foh C:241-341)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718307Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 718308Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 718371Family d.16.1.2: PHBH-like [54378] (2 proteins)
  6. 718409Protein Phenol hydroxylase [54382] (1 species)
    structurally very similar to PHBH, but contains additional C-terminal domain of the thioredoxin-like fold
  7. 718410Species Soil-living yeast (Trichosporon cutaneum) [TaxId:5554] [54383] (2 PDB entries)
  8. 718417Domain d1fohc4: 1foh C:241-341 [37902]
    Other proteins in same PDB: d1foha3, d1foha5, d1fohb3, d1fohb5, d1fohc3, d1fohc5, d1fohd3, d1fohd5

Details for d1fohc4

PDB Entry: 1foh (more details), 2.4 Å

PDB Description: phenol hydroxylase from trichosporon cutaneum
PDB Compounds: (C:) phenol hydroxylase

SCOP Domain Sequences for d1fohc4:

Sequence, based on SEQRES records: (download)

>d1fohc4 d.16.1.2 (C:241-341) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]}
geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqaraekgg
rvdrtkftpevvianakkifhpytfdvqqldwftayhigqr

Sequence, based on observed residues (ATOM records): (download)

>d1fohc4 d.16.1.2 (C:241-341) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]}
geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlrvdrtkft
pevvianakkifhpytfdvqqldwftayhigqr

SCOP Domain Coordinates for d1fohc4:

Click to download the PDB-style file with coordinates for d1fohc4.
(The format of our PDB-style files is described here.)

Timeline for d1fohc4: