![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.2: PHBH-like [54378] (4 proteins) |
![]() | Protein Phenol hydroxylase [54382] (1 species) structurally very similar to PHBH, but contains additional C-terminal domain of the thioredoxin-like fold |
![]() | Species Soil-living yeast (Trichosporon cutaneum) [TaxId:5554] [54383] (2 PDB entries) |
![]() | Domain d1fohb4: 1foh B:241-341 [37901] Other proteins in same PDB: d1foha3, d1foha5, d1fohb3, d1fohb5, d1fohc3, d1fohc5, d1fohd3, d1fohd5 complexed with fad, iph |
PDB Entry: 1foh (more details), 2.4 Å
SCOPe Domain Sequences for d1fohb4:
Sequence, based on SEQRES records: (download)
>d1fohb4 d.16.1.2 (B:241-341) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqaraekgg rvdrtkftpevvianakkifhpytfdvqqldwftayhigqr
>d1fohb4 d.16.1.2 (B:241-341) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} geqtdyiwgvldavpasnfpdirsrcaihsaesgsimiiprennlvrfyvqlqftpevvi anakkifhpytfdvqqldwftayhigqr
Timeline for d1fohb4: