Lineage for d6kllc1 (6kll C:4-146)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885355Species Mouse (Mus musculus) [TaxId:10090] [378951] (1 PDB entry)
  8. 2885358Domain d6kllc1: 6kll C:4-146 [379004]
    Other proteins in same PDB: d6klla2, d6kllb2, d6kllc2, d6klld2
    automated match to d1c0fa1
    complexed with adp, mg

Details for d6kllc1

PDB Entry: 6kll (more details), 3 Å

PDB Description: f-actin of cardiac thin filament in low-calcium state
PDB Compounds: (C:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d6kllc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kllc1 c.55.1.0 (C:4-146) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg

SCOPe Domain Coordinates for d6kllc1:

Click to download the PDB-style file with coordinates for d6kllc1.
(The format of our PDB-style files is described here.)

Timeline for d6kllc1: